PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F01779.1.p
Common NameEUGRSUZ_F01779
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 659aa    MW: 73060.9 Da    PI: 6.598
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F01779.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.2e-29328379152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek i+l++l++yF++++kdAAk+Lgvc+T+LKriCRq+GIkRWP+Rkik++
  Eucgr.F01779.1.p 328 AEKAITLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGIKRWPSRKIKKV 379
                       5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.564318399IPR003035RWP-RK domain
PfamPF020423.6E-26332379IPR003035RWP-RK domain
SuperFamilySSF542777.85E-21548639No hitNo description
Gene3DG3DSA:3.10.20.2406.4E-20552635No hitNo description
SMARTSM006664.2E-18554637IPR000270PB1 domain
PROSITE profilePS5174522.372554637IPR000270PB1 domain
CDDcd064072.53E-36555635No hitNo description
PfamPF005646.1E-14555636IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MTTQKIQYRP EIQSVCKALE AFDLRSSEVF GNLSEESHWK SYEAAIPEIR EVLRSACETH  60
GLPLAQTWVP CSQQGKGGCR HSNENYVHCV STIDHACHVA DPLLQPFHEA CSEHHLLKGQ  120
GVVGRAFQTN QPCFSSDITS SGRTEYPLSH HARMFGLCAA VAIRLRSIHT GTADFVLEFF  180
LPMDCKDHDK QKKMLGSLSI IIQQVCQSLR VITNEELEEE TVLPEIPVPS EGRPQGEWSL  240
EVESNYLERC SEEDLSWSAH VEKVQQSDTV ASATQKARAG ESFVEKSLDF GQFQDSSTER  300
GEDCSFYGEG RCSDAAREKT GDKKRTKAEK AITLQVLRQY FAGSLKDAAK SLGVCPTTLK  360
RICRQHGIKR WPSRKIKKVG HSLQKLQLVM DTVRVQGAPG PLQIDSFYTN FPELASPNLS  420
ITSPLSASNH GDHLQPLGTQ PGALNFDSCA AVSKSTSSSC SHSSSSSQCC SSGTKQHPSI  480
VDLVAEEDHL VSENNVDITP SKMVQSHVEL QGSSQEEQKL LPRSQSRRSF NPNMENPPRP  540
PPQYNCQASR EGDPLRVKVA CADENIRFRM QKDWDLKDLW GEIARRFCIE DTSKFDLKYL  600
DDDSEWVLLT CDADLDECID VSRSSPGSTV KLSVRKSHHR RLGSSLGSSG PPRMHGAS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F01779.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061177.10.0PREDICTED: protein NLP4-like
RefseqXP_010061178.10.0PREDICTED: protein NLP4-like
TrEMBLA0A059BPH80.0A0A059BPH8_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-146Nin-like family protein